Structure of PDB 4kgm Chain D

Receptor sequence
>4kgmD (length=224) Species: 339854 (Bacillus thuringiensis serovar israelensis ATCC 35646) [Search protein sequence]
SIGDRMKRYENAYRIKLPERMPVIVRIDGAHFHTYTKGCAKPFDQDLAEA
FWETCKYLAQNIMGAKLVYHQSDEISILITNYDKLTTQSWFENNLQKIAS
VSASMATAKFNEVMREKYPDKPLATFDGRAQVLPQDEVANYFIWRQQDAS
KNSISMVAQANFPNGKDMQDKLNWNDLPVWQKRGICIIKEFYEKNGALRS
RWSVDHETPIISKDREYVEQFVYL
3D structure
PDB4kgm Structural Studies of a Bacterial tRNA(HIS) Guanylyltransferase (Thg1)-Like Protein, with Nucleotide in the Activation and Nucleotidyl Transfer Sites.
ChainD
Resolution2.361 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ATP D D30 G31 H33 F34 H35 D46 L49 S74 D75 D28 G29 H31 F32 H33 D44 L47 S72 D73
BS02 MG D D30 G31 D75 D28 G29 D73
BS03 MG D D30 D75 D28 D73
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Wed Dec 18 21:53:36 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4kgm', asym_id = 'D', title = 'Structural Studies of a Bacterial tRNA(HIS) Guan...n the Activation and Nucleotidyl Transfer Sites. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4kgm', asym_id='D', title='Structural Studies of a Bacterial tRNA(HIS) Guan...n the Activation and Nucleotidyl Transfer Sites. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0000287,0006400,0008193', uniprot = '', pdbid = '4kgm', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000287,0006400,0008193', uniprot='', pdbid='4kgm', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>