Structure of PDB 4k85 Chain D

Receptor sequence
>4k85D (length=207) Species: 9606 (Homo sapiens) [Search protein sequence]
FNLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDV
VSKLRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRT
VLRLHRALHWLQLFLEGLRTSPEDARTSALCADSYNASLAAYHPWVVRRA
VTVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVYNVSQKLYAE
HSLLDLP
3D structure
PDB4k85 Non-vesicular trafficking by a ceramide-1-phosphate transfer protein regulates eicosanoids.
ChainD
Resolution1.901 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 1PZ D F50 A157 F43 A150
BS02 1PZ D F42 F50 I53 D56 K60 R106 R110 W117 Y142 H150 F35 F43 I46 D49 K53 R99 R103 W110 Y135 H143
Gene Ontology
Molecular Function
GO:0005543 phospholipid binding
GO:0008289 lipid binding
GO:0120013 lipid transfer activity
GO:1902387 ceramide 1-phosphate binding
GO:1902388 ceramide 1-phosphate transfer activity
Biological Process
GO:0006869 lipid transport
GO:0010507 negative regulation of autophagy
GO:0032691 negative regulation of interleukin-1 beta production
GO:0035627 ceramide transport
GO:0046836 glycolipid transport
GO:0120009 intermembrane lipid transfer
GO:1900226 negative regulation of NLRP3 inflammasome complex assembly
GO:1902389 ceramide 1-phosphate transport
Cellular Component
GO:0005634 nucleus
GO:0005640 nuclear outer membrane
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0010008 endosome membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4k85, PDBe:4k85, PDBj:4k85
PDBsum4k85
PubMed23863933
UniProtQ5TA50|CPTP_HUMAN Ceramide-1-phosphate transfer protein (Gene Name=CPTP)

[Back to BioLiP]