Structure of PDB 4jav Chain D |
>4javD (length=120) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] |
SKKVLLVDDSAPIRKMVSFVLKKEGYEVIEAENGQIALEKLSEFTPDLIV LDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARK VMRKPFSPSQFIEEVKHLLN |
|
PDB | 4jav Structural basis of a rationally rewired protein-protein interface critical to bacterial signaling |
Chain | D |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
D |
D10 X53 M55 |
D9 X52 M54 |
|
|
|
|