Structure of PDB 4j8v Chain D

Receptor sequence
>4j8vD (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence]
KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
3D structure
PDB4j8v Novel metal(II) arene 2-pyridinecarbothioamides: a rationale to orally active organometallic anticancer agents
ChainD
Resolution2.58 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D K28 T29 S52 S53 R83 S84 T85 K1 T2 S25 S26 R56 S57 T58
BS02 dna D R30 K31 E32 S33 Y37 R3 K4 E5 S6 Y10
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4j8v, PDBe:4j8v, PDBj:4j8v
PDBsum4j8v
PubMed
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]