Structure of PDB 4iro Chain D

Receptor sequence

>4iroD (length=146) Species: 40690 (Trematomus bernacchii)

VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGFGNLYN
AEAIIGNANVAAHGIKVLHGLDRGVKNMDNIAATYADLSTLHSEKLHVDP
DNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH

3D structure

• PDB: 4iro Role of tertiary structures on the Root effect in fish hemoglobins.
• Chain: D
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	D	H41 F42 H63 K66 V67 L71 H92 L96 V98 F103 L141	H41 F42 H63 K66 V67 L71 H92 L96 V98 F103 L141

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:4iro, PDBe:4iro, PDBj:4iro
• PDBsum: 4iro
• PubMed: 23376186
• UniProt: P80044|HBB_TREBE Hemoglobin subunit beta (Gene Name=hbb)