Structure of PDB 4hjv Chain D

Receptor sequence
>4hjvD (length=182) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
YTNPPWNAKVPVQRAMQWMPISQKAGAAWGVDPQLITAIIAIESGGNPNA
VSKSNAIGLMQLKASTSGRDVYRRMGWSGEPTTSELKNPERNISMGAAYL
NILETGPLAGIEDPKVLQYALVVSYANGAGALLRTFSSDRKKAISKINDL
DADEFLEHVARNHPAPQAPRYIYKLEQALDAM
3D structure
PDB4hjv On the Mechanism of Peptidoglycan Binding and Cleavage by the endo-Specific Lytic Transglycosylase MltE from Escherichia coli.
ChainD
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 4.2.2.n2: peptidoglycan lytic endotransglycosylase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AMU D W27 E64 R191 K195 W6 E43 R170 K174
BS02 BLG D E64 S73 S75 Q82 K84 T87 S88 Y120 Y146 A147 N148 G149 E43 S52 S54 Q61 K63 T66 S67 Y99 Y125 A126 N127 G128
Gene Ontology
Molecular Function
GO:0008932 lytic endotransglycosylase activity
GO:0008933 lytic transglycosylase activity
GO:0016829 lyase activity
GO:0016837 carbon-oxygen lyase activity, acting on polysaccharides
Biological Process
GO:0000270 peptidoglycan metabolic process
GO:0016998 cell wall macromolecule catabolic process
GO:0051301 cell division
GO:0071555 cell wall organization
Cellular Component
GO:0009279 cell outer membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4hjv, PDBe:4hjv, PDBj:4hjv
PDBsum4hjv
PubMed23075328
UniProtP0C960|EMTA_ECOLI Endo-type membrane-bound lytic murein transglycosylase A (Gene Name=emtA)

[Back to BioLiP]