Structure of PDB 4hjb Chain D

Receptor sequence
>4hjbD (length=30) [Search protein sequence]
RMKQIEDKLEEILSKLYHIEMELFIKMLLG
3D structure
PDB4hjb Differential Impact of beta and gamma Residue Preorganization on alpha / beta / gamma-Peptide Helix Stability in Water.
ChainD
Resolution1.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D R1 Q4 R1 Q4
BS02 peptide D R1 I5 K8 I12 K15 H18 I19 E22 I25 L28 R1 I5 K8 I12 K15 H18 I19 E22 I25 L28
External links