Structure of PDB 4h2x Chain D |
>4h2xD (length=75) Species: 176299 (Agrobacterium fabrum str. C58) [Search protein sequence] |
MNATIREILAKFGQLPTPVDTIADEADLYAAGLSSFASVQLMLGIEEAFD IEFPDNLLNRKSFASIKAIEDTVKL |
|
PDB | 4h2x Adaptation of aminoacyl-tRNA synthetase catalytic core to carrier protein aminoacylation. |
Chain | D |
Resolution | 2.15 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
PNS |
D |
S35 F36 |
S35 F36 |
|
|
|
|