Structure of PDB 4guk Chain D

Receptor sequence
>4gukD (length=180) Species: 9606 (Homo sapiens) [Search protein sequence]
SKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQF
FPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAF
KLYDLDNDGYITRNEMLDIVDAIYQMVLPEEENTPEKRVDRIFAMMDKNA
DGKLTLQEFQEGSKADPSIVQALSLYDGLV
3D structure
PDB4guk new crystal form structure of human NCS1
ChainD
Resolution1.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA D D73 N75 D77 R79 E84 D68 N70 D72 R74 E79
BS02 CA D D109 D111 D113 Y115 E120 D104 D106 D108 Y110 E115
BS03 CA D D157 N159 D161 K163 E168 D147 N149 D151 K153 E158
Gene Ontology
Molecular Function
GO:0005245 voltage-gated calcium channel activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008048 calcium sensitive guanylate cyclase activator activity
GO:0046872 metal ion binding
Biological Process
GO:0010975 regulation of neuron projection development
GO:0070588 calcium ion transmembrane transport
Cellular Component
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0014069 postsynaptic density
GO:0030424 axon
GO:0030425 dendrite
GO:0043231 intracellular membrane-bounded organelle
GO:0045202 synapse
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4guk, PDBe:4guk, PDBj:4guk
PDBsum4guk
PubMed
UniProtP62166|NCS1_HUMAN Neuronal calcium sensor 1 (Gene Name=NCS1)

[Back to BioLiP]