Structure of PDB 4giz Chain D

Receptor sequence

>4gizD (length=142) Species: 333760 (Human papillomavirus 16) [Search protein sequence]

FQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFARRDLC
IVYRDGNPYAVCDKCLKFYSKISEYRHYSYSLYGTTLEQQYNKPLSDLLI
RCINCQKPLSPEEKQRHLDKKQRFHNIRGRWTGRCMSCSRSS

3D structure

PDB

4giz Structural basis for hijacking of cellular LxxLL motifs by papillomavirus E6 oncoproteins.

Chain

Resolution

2.55 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	C103 C106 C136 C139	C102 C105 C135 C138
BS02	ZN	D	C30 C33 C66	C29 C32 C65

Gene Ontology

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0019049	virus-mediated perturbation of host defense response
GO:0030162	regulation of proteolysis
GO:0039502	symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039548	symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF3 activity
GO:0039648	symbiont-mediated perturbation of host ubiquitin-like protein modification
GO:0039653	symbiont-mediated suppression of host transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0052150	symbiont-mediated perturbation of host apoptosis
GO:0090630	activation of GTPase activity

	Cellular Component
GO:0030430	host cell cytoplasm
GO:0042025	host cell nucleus

External links