Structure of PDB 4gbn Chain D

Receptor sequence
>4gbnD (length=30) Species: 9606 (Homo sapiens) [Search protein sequence]
FVNQHLCGSHLVEALYLVCGERGFFYTDKT
3D structure
PDB4gbn A T3R3 hexamer of the human insulin variant B28Asp.
ChainD
Resolution1.872 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D G8 V12 E13 Y16 R22 G23 F24 F25 Y26 D28 K29 G8 V12 E13 Y16 R22 G23 F24 F25 Y26 D28 K29
BS02 peptide D F1 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 D28 T30 F1 H5 L6 C7 L11 L15 V18 C19 R22 G23 F24 F25 Y26 D28 T30
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:4gbn, PDBe:4gbn, PDBj:4gbn
PDBsum4gbn
PubMed23428413
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]