Structure of PDB 4g5r Chain D

Receptor sequence

>4g5rD (length=317) Species: 9606 (Homo sapiens) [Search protein sequence]

KEVKLLLLGAGESGKSTIVKQMKIIHEDGYSEDECKQYKVVVYSNTIQSI
IAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMTPELAGVIKRLW
RDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVKT
TGIVETHFTFKDLYFKMFDVERKKWIHCFEGVTAIIFCVALSDYDLVLAE
DEEMNRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTIC
YPEYTGSNTYEEAAAYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVF
DAVTDVIIKNNLKECGL

3D structure

PDB

4g5r Crystal Structures of the scaffolding protein LGN reveal the general mechanism by which GoLoco binding motifs inhibit the release of GDP from Galphai subunits in G-coupled heterotrimeric proteins

Chain

Resolution

3.481 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	E43 T48 R178 D200
Catalytic site (residue number reindexed from 1)	E12 T17 R147 D169
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	L39 G40 E43 N76 Q79 A83 Q147 N149 R178 V179 K180 T181 F215 N256	L8 G9 E12 N45 Q48 A52 Q116 N118 R147 V148 K149 T150 F179 N220
BS02	GDP	D	E43 S44 G45 K46 S47 T48 D150 S151 R176 R178 N269 K270 D272 L273 C325 A326 T327	E12 S13 G14 K15 S16 T17 D119 S120 R145 R147 N233 K234 D236 L237 C289 A290 T291

Gene Ontology

	Molecular Function
GO:0001664	G protein-coupled receptor binding
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0019001	guanyl nucleotide binding
GO:0019003	GDP binding
GO:0031683	G-protein beta/gamma-subunit complex binding
GO:0046872	metal ion binding

	Biological Process
GO:0007165	signal transduction
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007188	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0007194	negative regulation of adenylate cyclase activity
GO:0007212	G protein-coupled dopamine receptor signaling pathway
GO:0016239	positive regulation of macroautophagy
GO:0046039	GTP metabolic process
GO:0051301	cell division

	Cellular Component
GO:0000139	Golgi membrane
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005765	lysosomal membrane
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0005813	centrosome
GO:0005834	heterotrimeric G-protein complex
GO:0005856	cytoskeleton
GO:0005886	plasma membrane
GO:0016020	membrane
GO:0030496	midbody
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4g5r, PDBe:4g5r, PDBj:4g5r
PDBsum	4g5r
PubMed
UniProt	P08754\|GNAI3_HUMAN Guanine nucleotide-binding protein G(i) subunit alpha-3 (Gene Name=GNAI3)

[Back to BioLiP]