Structure of PDB 4g51 Chain D

Receptor sequence
>4g51D (length=146) Species: 40690 (Trematomus bernacchii) [Search protein sequence]
VEWTDKERSIISDIFSHMDYDDIGPKALSRCLIVYPWTQRHFSGFGNLYN
AEAIIGNANVAAHGIKVLHGLDRGVKNMDNIAATYADLSTLHSEKLHVDP
DNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAVVVSALGKQYH
3D structure
PDB4g51 Selective X-ray-induced NO photodissociation in haemoglobin crystals: evidence from a Raman-assisted crystallographic study.
ChainD
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NO D H63 V67 H63 V67
BS02 HEM D T38 H63 K66 V67 H92 L96 V98 N102 F103 T38 H63 K66 V67 H92 L96 V98 N102 F103
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4g51, PDBe:4g51, PDBj:4g51
PDBsum4g51
PubMed23275172
UniProtP80044|HBB_TREBE Hemoglobin subunit beta (Gene Name=hbb)

[Back to BioLiP]