Structure of PDB 4fyy Chain D

Receptor sequence
>4fyyD (length=148) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
KLQVEAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGEMGR
KDLIKIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPERIDN
VLVCPNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN
3D structure
PDB4fyy Metal Ion Involvement in the Allosteric Mechanism of Escherichia coli Aspartate Transcarbamoylase.
ChainD
Resolution1.9395 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN D C109 C114 C138 C141 C104 C109 C133 C136
BS02 UTP D L7 Q8 V9 H20 P49 S50 E52 K56 K60 L2 Q3 V4 H15 P44 S45 E47 K51 K55
BS03 CTP D A11 I12 H20 K60 N84 Y89 V91 K94 A6 I7 H15 K55 N79 Y84 V86 K89
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
GO:0006221 pyrimidine nucleotide biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0009347 aspartate carbamoyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fyy, PDBe:4fyy, PDBj:4fyy
PDBsum4fyy
PubMed22906065
UniProtP0A7F3|PYRI_ECOLI Aspartate carbamoyltransferase regulatory chain (Gene Name=pyrI)

[Back to BioLiP]