Structure of PDB 4fyw Chain D

Receptor sequence

>4fywD (length=144) Species: 83333 (Escherichia coli K-12)

EAIKRGTVIDHIPAQIGFKLLSLFKLTETDQRITIGLNLPSGEMGRKDLI
KIENTFLSEDQVDQLALYAPQATVNRIDNYEVVGKSRPSLPERIDNVLVC
PNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN

3D structure

• PDB: 4fyw Metal Ion Involvement in the Allosteric Mechanism of Escherichia coli Aspartate Transcarbamoylase.
• Chain: D
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	D	C109 C114 C138 C141	C100 C105 C129 C132
BS02	CTP	D	A11 I12 V17 D19 K60 N84 I86 Y89 V91 K94	A2 I3 V8 D10 K51 N75 I77 Y80 V82 K85

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0009347 aspartate carbamoyltransferase complex

External links

• PDB: RCSB:4fyw, PDBe:4fyw, PDBj:4fyw
• PDBsum: 4fyw
• PubMed: 22906065
• UniProt: P0A7F3|PYRI_ECOLI Aspartate carbamoyltransferase regulatory chain (Gene Name=pyrI)