Structure of PDB 4fgc Chain D

Receptor sequence
>4fgcD (length=145) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
NYLFEYAPDVLESFPNKHVNRDYFVKFNCPEFTSLAPKTGQPDFATIYIS
YIPDEKMVESKSLKLYLFSFRNHGDFHEDCMNIIMNDLIELMDPRYIEVW
GKFTPRGGISIDPYTNYGKPGTKYEKMAEYRMMNHDLYPETIDNR
3D structure
PDB4fgc Structural basis of biological nitrile reduction.
ChainD
Resolution2.498 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) A55 T58 D62 H96 E97
Catalytic site (residue number reindexed from 1) A36 T39 D43 H77 E78
Enzyme Commision number 1.7.1.13: preQ1 synthase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PQ0 D A55 P56 F95 H96 E97 I130 A36 P37 F76 H77 E78 I111
BS02 CA D D162 R164 D143 R145
BS03 CA D S53 L54 D62 D94 S34 L35 D43 D75
BS04 PQ0 D F33 E78 S79 F14 E59 S60
Gene Ontology
Molecular Function
GO:0016491 oxidoreductase activity
GO:0033739 preQ1 synthase activity
GO:0046857 oxidoreductase activity, acting on other nitrogenous compounds as donors, with NAD or NADP as acceptor
GO:0046872 metal ion binding
Biological Process
GO:0006400 tRNA modification
GO:0008616 queuosine biosynthetic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4fgc, PDBe:4fgc, PDBj:4fgc
PDBsum4fgc
PubMed22787148
UniProtO31678|QUEF_BACSU NADPH-dependent 7-cyano-7-deazaguanine reductase (Gene Name=queF)

[Back to BioLiP]