Structure of PDB 4ejf Chain D

Receptor sequence
>4ejfD (length=243) Species: 9606 (Homo sapiens) [Search protein sequence]
MFDPAEKYKMDHRRRGIALIFNHERFFWHLTLPERRGTCADRDNLTRRFS
DLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYA
YDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQAARGNTNITEVDAASVYT
LPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYGSSLEFTELL
TLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKS
3D structure
PDB4ejf Allosteric peptides bind a caspase zymogen and mediate caspase tetramerization.
ChainD
Resolution2.6465 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) P62 E63 H121 G122 A163 R164
Catalytic site (residue number reindexed from 1) P33 E34 H92 G93 A134 R135
Enzyme Commision number 3.4.22.59: caspase-6.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D F56 E94 L97 A132 K133 F27 E65 L68 A103 K104
BS02 peptide D F56 H58 E94 F27 H29 E65
Gene Ontology
Molecular Function
GO:0004175 endopeptidase activity
GO:0004197 cysteine-type endopeptidase activity
GO:0005515 protein binding
GO:0008234 cysteine-type peptidase activity
GO:0042802 identical protein binding
GO:0097153 cysteine-type endopeptidase activity involved in apoptotic process
GO:0097200 cysteine-type endopeptidase activity involved in execution phase of apoptosis
Biological Process
GO:0002218 activation of innate immune response
GO:0006508 proteolysis
GO:0006915 apoptotic process
GO:0016540 protein autoprocessing
GO:0030855 epithelial cell differentiation
GO:0043065 positive regulation of apoptotic process
GO:0043067 regulation of programmed cell death
GO:0043525 positive regulation of neuron apoptotic process
GO:0051604 protein maturation
GO:0060545 positive regulation of necroptotic process
GO:0070269 pyroptotic inflammatory response
GO:0072332 intrinsic apoptotic signaling pathway by p53 class mediator
GO:0072734 cellular response to staurosporine
GO:0097194 execution phase of apoptosis
GO:0097284 hepatocyte apoptotic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ejf, PDBe:4ejf, PDBj:4ejf
PDBsum4ejf
PubMed22683611
UniProtP55212|CASP6_HUMAN Caspase-6 (Gene Name=CASP6)

[Back to BioLiP]