Structure of PDB 4eb5 Chain D

Receptor sequence

>4eb5D (length=138) Species: 224325 (Archaeoglobus fulgidus DSM 4304)

YSDKVFDHFQNPRNVGKIEDADGVGTVGNPVCGDLMTIYIKVKDNRIEDI
KFQTFGCAAAIATSSMATEMAKGKTIEEALKITRDAVAEALGGLPKQKMH
CSNLAADALRRAIVDYFRKNGKIDKIKELGLEKELEKM

3D structure

• PDB: 4eb5 (IscS-IscU)2 complex structures provide insights into Fe2S2 biogenesis and transfer.
• Chain: D
• Resolution: 2.53 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	D	C33 D35 C58 A61 H101 C102	C32 D34 C57 A60 H100 C101

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0008198 ferrous iron binding
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006879 intracellular iron ion homeostasis
• GO:0016226 iron-sulfur cluster assembly

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4eb5, PDBe:4eb5, PDBj:4eb5
• PDBsum: 4eb5
• PubMed: 22511353
• UniProt: P0DMG2|ISCU2_ARCFU Iron-sulfur cluster assembly scaffold protein IscU 2 (Gene Name=iscU2)