Structure of PDB 4d8j Chain D

Receptor sequence
>4d8jD (length=149) Species: 562 (Escherichia coli) [Search protein sequence]
MKYQQLENLESGWKWKYLVKKHREGELITRYIEASAAQEAVDVLLSLENE
PVLVNGWIDKHMNPELVNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFIV
WQRLAGLAQRRGKTLSETIVQLIEDAENKEKYANKMSSLKQDLQALLGK
3D structure
PDB4d8j Molecular basis for a protein-mediated DNA-bridging mechanism that functions in condensation of the E. coli chromosome.
ChainD
Resolution3.55 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D Y3 K71 R75 R78 W101 T114 L115 Y3 K71 R75 R78 W101 T114 L115
BS02 dna D Y17 K20 R69 Q72 T73 R77 R80 K92 S93 D95 Y17 K20 R69 Q72 T73 R77 R80 K92 S93 D95
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0005543 phospholipid binding
GO:0042803 protein homodimerization activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0007059 chromosome segregation
GO:0051276 chromosome organization
GO:0051289 protein homotetramerization
GO:0051301 cell division
Cellular Component
GO:0005737 cytoplasm
GO:0097047 DNA replication termination region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4d8j, PDBe:4d8j, PDBj:4d8j
PDBsum4d8j
PubMed23084832
UniProtP0A8N0|MATP_ECOLI Macrodomain Ter protein (Gene Name=matP)

[Back to BioLiP]