Structure of PDB 4d0m Chain D

Receptor sequence
>4d0mD (length=173) Species: 9606 (Homo sapiens) [Search protein sequence]
DEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQV
DGKTIKAQIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERW
LKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSA
LDSTNVEAAFQTILTEIYRIVSQ
3D structure
PDB4d0m Structures of Pi4Kiiibeta Complexes Show Simultaneous Recruitment of Rab11 and its Effectors.
ChainD
Resolution6.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GSP D S20 G21 G23 K24 S25 N26 F36 N37 L38 S40 S42 T43 N124 K125 D127 L128 S154 L156 S15 G16 G18 K19 S20 N21 F31 N32 L33 S35 S37 T38 N119 K120 D122 L123 S149 L151
BS02 MG D S25 T43 S20 T38
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0008017 microtubule binding
GO:0016787 hydrolase activity
GO:0019905 syntaxin binding
GO:0031489 myosin V binding
GO:0051959 dynein light intermediate chain binding
Biological Process
GO:0006887 exocytosis
GO:0007080 mitotic metaphase chromosome alignment
GO:0010634 positive regulation of epithelial cell migration
GO:0010796 regulation of multivesicular body size
GO:0010971 positive regulation of G2/M transition of mitotic cell cycle
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0030953 astral microtubule organization
GO:0031175 neuron projection development
GO:0032402 melanosome transport
GO:0032465 regulation of cytokinesis
GO:0034394 protein localization to cell surface
GO:0036258 multivesicular body assembly
GO:0043001 Golgi to plasma membrane protein transport
GO:0048227 plasma membrane to endosome transport
GO:0051650 establishment of vesicle localization
GO:0060627 regulation of vesicle-mediated transport
GO:0061502 early endosome to recycling endosome transport
GO:0061512 protein localization to cilium
GO:0071806 protein transmembrane transport
GO:0072594 establishment of protein localization to organelle
GO:0072659 protein localization to plasma membrane
GO:0090150 establishment of protein localization to membrane
GO:0090307 mitotic spindle assembly
GO:0098887 neurotransmitter receptor transport, endosome to postsynaptic membrane
GO:0150093 amyloid-beta clearance by transcytosis
GO:1902017 regulation of cilium assembly
GO:1902954 regulation of early endosome to recycling endosome transport
GO:1903438 positive regulation of mitotic cytokinetic process
GO:1904779 regulation of protein localization to centrosome
GO:1990182 exosomal secretion
GO:2001135 regulation of endocytic recycling
Cellular Component
GO:0000139 Golgi membrane
GO:0000922 spindle pole
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005771 multivesicular body
GO:0005794 Golgi apparatus
GO:0005802 trans-Golgi network
GO:0005813 centrosome
GO:0005814 centriole
GO:0005828 kinetochore microtubule
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030133 transport vesicle
GO:0030659 cytoplasmic vesicle membrane
GO:0030666 endocytic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0031982 vesicle
GO:0032154 cleavage furrow
GO:0032588 trans-Golgi network membrane
GO:0032991 protein-containing complex
GO:0034451 centriolar satellite
GO:0043231 intracellular membrane-bounded organelle
GO:0045335 phagocytic vesicle
GO:0055037 recycling endosome
GO:0055038 recycling endosome membrane
GO:0070062 extracellular exosome
GO:0098837 postsynaptic recycling endosome
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4d0m, PDBe:4d0m, PDBj:4d0m
PDBsum4d0m
PubMed24876499
UniProtP62491|RB11A_HUMAN Ras-related protein Rab-11A (Gene Name=RAB11A)

[Back to BioLiP]