Structure of PDB 4cz6 Chain D

Receptor sequence
>4cz6D (length=33) Species: 7955 (Danio rerio) [Search protein sequence]
GGSEEIFTLQVRGRERYEILKKLNDSLELSDVV
3D structure
PDB4cz6 Tracing the Evolution of the P53 Tetramerization Domain
ChainD
Resolution1.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D S324 L325 S328 V330 S26 L27 S30 V32
BS02 peptide D G299 S301 E303 I304 F305 T306 L307 Q308 V309 R310 G311 R312 R314 Y315 L318 N322 L325 E326 V331 G1 S3 E5 I6 F7 T8 L9 Q10 V11 R12 G13 R14 R16 Y17 L20 N24 L27 E28 V33
Gene Ontology
Biological Process
GO:0051262 protein tetramerization

View graph for
Biological Process
External links
PDB RCSB:4cz6, PDBe:4cz6, PDBj:4cz6
PDBsum4cz6
PubMed25185827
UniProtP79734|P53_DANRE Cellular tumor antigen p53 (Gene Name=tp53)

[Back to BioLiP]