Structure of PDB 4cn2 Chain D

Receptor sequence
>4cn2D (length=81) Species: 9606 (Homo sapiens) [Search protein sequence]
KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDK
RQRNRCQYCRYQKCLAMGMKREAVQEERQRG
3D structure
PDB4cn2 Structural Basis of Natural Promoter Recognition by the Retinoid X Nuclear Receptor.
ChainD
Resolution2.069 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D K145 H146 Y147 K160 R164 Q206 E208 R209 R211 G212 K14 H15 Y16 K29 R33 Q75 E77 R78 R80 G81 PDBbind-CN: Kd=38nM
BS02 dna D E153 G154 F158 R161 R184 N185 Q188 R191 E22 G23 F27 R30 R53 N54 Q57 R60 PDBbind-CN: Kd=38nM
BS03 ZN D C135 C138 C155 C4 C7 C24
BS04 ZN D C171 C177 C187 C190 C40 C46 C56 C59
BS05 MG D G154 F158 R161 G23 F27 R30
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4cn2, PDBe:4cn2, PDBj:4cn2
PDBsum4cn2
PubMed25645674
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]