Structure of PDB 4cfq Chain D

Receptor sequence
>4cfqD (length=84) Species: 9606 (Homo sapiens) [Search protein sequence]
MASPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRT
DEAAFQKLMSNLDSNRDNEVDFQEYCVFLSSIAM
3D structure
PDB4cfq The C-Terminal Random Coil Region Tunes the Ca2+-Binding Affinity of S100A4 Through Conformational Activation.
ChainD
Resolution1.37 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D F45 L46 G47 T50 A54 F55 K57 N61 S80 S81 F45 L46 G47 T50 A54 F55 K57 N61 S80 S81
BS02 CA D S20 E23 D25 K28 E33 S20 E23 D25 K28 E33
BS03 CA D D63 N65 D67 E69 E74 D63 N65 D67 E69 E74
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0046914 transition metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:4cfq, PDBe:4cfq, PDBj:4cfq
PDBsum4cfq
PubMed24830809
UniProtP26447|S10A4_HUMAN Protein S100-A4 (Gene Name=S100A4)

[Back to BioLiP]