Structure of PDB 4ce4 Chain D

Receptor sequence

>4ce4D (length=200) Species: 9825 (Sus scrofa domesticus) [Search protein sequence]

MPVKMRKSGGRNHTGQIQVHGIGGGHKQRYRMIDFLRFRPEHESKPGPFE
EKVIAVRYDPCRSADIALVAGGNRKRWIIATENMKAGDTVLNSDHIGRMA
VAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLLRKVNGT
AIIQLPSKRQMQVLETCIATVGRVSNVDHNKRVIGKAGRNRWLGKRPNSG

3D structure

PDB

4ce4 Architecture of the Large Subunit of the Mammalian Mitochondrial Ribosome.

Chain

Resolution

4.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	K81 G84 R85 H87 Q90 I91 Q92 V93 G97 G98 H100 K101 Q102 R103 Y104 Y132 P134 C135 W151 R203 Q206 Y207 I208 R209 A210 A211 G212 T213 L229 P230 S231 R233 M235 H253 N254 I258 G259 K260 A261 G262 N264 W266 R270 S273 G274	K7 G10 R11 H13 Q16 I17 Q18 V19 G23 G24 H26 K27 Q28 R29 Y30 Y58 P60 C61 W77 R129 Q132 Y133 I134 R135 A136 A137 G138 T139 L155 P156 S157 R159 M161 H179 N180 I184 G185 K186 A187 G188 N190 W192 R196 S199 G200

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0031090	organelle membrane
GO:0043231	intracellular membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ce4, PDBe:4ce4, PDBj:4ce4
PDBsum	4ce4
PubMed	24362565
UniProt	F1RRN2

[Back to BioLiP]