Structure of PDB 4alj Chain D

Receptor sequence

>4aljD (length=254) Species: 1280 (Staphylococcus aureus)

NLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLL
EQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDL
RGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEF
AVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVG
GFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGF
HAIK

3D structure

• PDB: 4alj Staphylococcus Aureus Fabi: Inhibition, Substrate Recognition and Potential Implications for in Vivo Essentiality
• Chain: D
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y147 Y157 M160 K164 K199
• Catalytic site (residue number reindexed from 1): Y145 Y155 M158 K162 K197
• Enzyme Commision number: 1.3.1.39: enoyl-[acyl-carrier-protein] reductase (NADPH, Re-specific).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	D	G13 A15 S19 I20 R40 K41 S44 D66 V67 S93 I94 A95 T145 T146 Y147 K164 A190 P192 I193 T195 S197	G11 A13 S17 I18 R38 K39 S42 D64 V65 S91 I92 A93 T143 T144 Y145 K162 A188 P190 I191 T193 S195
BS02	CH8	D	A95 L102 Y147 Y157 S197 A198 V201	A93 L100 Y145 Y155 S195 A196 V199

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity
• GO:0016491 oxidoreductase activity
• GO:0042802 identical protein binding
• GO:0141148 enoyl-[acyl-carrier-protein] reductase (NADPH) activity

Biological Process

• GO:0006633 fatty acid biosynthetic process

External links

• PDB: RCSB:4alj, PDBe:4alj, PDBj:4alj
• PDBsum: 4alj
• PubMed: 22579249
• UniProt: A0A0H3JLH9