Structure of PDB 4afg Chain D

Receptor sequence

>4afgD (length=212) Species: 283909 (Capitella teleta)

NGLMAKRLRRELLNTYEQLGKSGLPFLDDIGKVDVKFGLSLQLLKSIEQR
GMGFNSIGTFKAIVKLSWVDTILRWDPEPPFDFQKIEISPDEIWTPDIKL
FNSVDLDMTLDRTTQAIVFSNGTVLWIPPAVLKVLCVSQDDVDSCHFQFG
SWVYSVDEVDIHFMDDKAEVLLDFYQDSLEILENSAQRQEVVYPCCESAY
VEMKYLLALRSE

3D structure

• PDB: 4afg Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
• Chain: D
• Resolution: 2.001 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	QMR	D	W153 C197 Y201	W152 C196 Y200	MOAD: Ki=5nM
BS02	QMR	D	I118 I128	I117 I127	MOAD: Ki=5nM

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0005231 excitatory extracellular ligand-gated monoatomic ion channel activity
• GO:0042802 identical protein binding
• GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007165 signal transduction
• GO:0007268 chemical synaptic transmission
• GO:0034220 monoatomic ion transmembrane transport
• GO:0042391 regulation of membrane potential
• GO:0050877 nervous system process
• GO:0060078 regulation of postsynaptic membrane potential
• GO:0060079 excitatory postsynaptic potential

Cellular Component

• GO:0016020 membrane
• GO:0043005 neuron projection
• GO:0045202 synapse
• GO:0098794 postsynapse

External links

• PDB: RCSB:4afg, PDBe:4afg, PDBj:4afg
• PDBsum: 4afg
• PubMed: 22619328
• UniProt: I6L8L2