Structure of PDB 4a99 Chain D

Receptor sequence

>4a99D (length=367) Species: 818 (Bacteroides thetaiotaomicron)

NLLSDKNVAIIGGGPVGLTMAKLLQQNGIDVSVYERDNDREARIFGGTLD
LHKGSGQEAMKKAGLLQTYYDLALPMGVNIADEKGNILSTKNVKPENRFD
NPEINRNDLRAILLNSLENDTVIWDRKLVMLEPGKKKWTLTFENKPSETA
DLVILANGGMSKVRKFVTDTEVEETGTFNIQADIHQPEINCPGFFQLCNG
NRLMASHQGNLLFANPNNNGALHFGISFKTPDEWQVDFQNRNSVVDFLLK
EFSDWDERYKELIHTTLSFVGLATRIFPLEKPWKSKRPLPITMIGDAAHL
MPPFAGQGVNSGLVDALILSDNLADGKFNSIEEAVKNYEQQMFIYGKEAQ
EESTQNEIEMFKPDFTF

3D structure

• PDB: 4a99 Putative Dioxygen-Binding Sites and Recognition of Tigecycline and Minocycline in the Tetracycline-Degrading Monooxygenase Tetx
• Chain: D
• Resolution: 2.18 Å

Enzymatic activity

• Enzyme Commision number: 1.14.13.231: tetracycline 11a-monooxygenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	D	G23 G25 P26 V27 E46 R47 R117 R137 L139 N168 G169 G310 D311 P318 G323 V324	G12 G14 P15 V16 E35 R36 R106 R126 L128 N157 G158 G295 D296 P303 G308 V309
BS02	MIY	D	M215 F224 N226 H234 P318 F319 A320 G321	M204 F213 N215 H223 P303 F304 A305 G306
BS03	MIY	D	G65 S326 V329	G54 S311 V314
BS04	MIY	D	Q356 I359 Y360 E363	Q341 I344 Y345 E348

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004497 monooxygenase activity
• GO:0071949 FAD binding

Biological Process

• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4a99, PDBe:4a99, PDBj:4a99
• PDBsum: 4a99
• PubMed: 23999299
• UniProt: Q93L51|TETX_BACT4 Flavin-dependent monooxygenase (Gene Name=tetX2)