Structure of PDB 3zo7 Chain D |
>3zo7D (length=91) Species: 37919 (Rhodococcus opacus) [Search protein sequence] |
MLYLVRMTVNLPRNLDPREEERLKASAKARSRTLQEQGQWRYLWRTTGKY GNISVFDVNSHDELHEILWSLPFFPYLTIDVEPLSHHPARV |
|
PDB | 3zo7 Crystal Structure and Catalytic Mechanism of Chloromuconolactone Dehalogenase Clcf from Rhodococcus Opacus 1Cp. |
Chain | D |
Resolution | 2.224 Å |
3D structure |
|
|
Enzyme Commision number |
5.3.3.4: muconolactone Delta-isomerase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
K6H |
D |
N52 F73 |
N52 F73 |
|
|
|
|