Structure of PDB 3x1v Chain D

Receptor sequence
>3x1vD (length=99) Species: 10090 (Mus musculus) [Search protein sequence]
RKRKRCRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
3D structure
PDB3x1v Structural and functional analyses of nucleosome complexes with mouse histone variants TH2a and TH2b, involved in reprogramming
ChainD
Resolution2.921 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D K30 C32 Y42 G53 I54 S55 S56 R86 S87 T88 K4 C6 Y16 G27 I28 S29 S30 R60 S61 T62
BS02 dna D K28 R29 K30 R31 R33 K34 S36 I39 Y40 K2 R3 K4 R5 R7 K8 S10 I13 Y14
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0042393 histone binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006337 nucleosome disassembly
GO:0006954 inflammatory response
GO:0031639 plasminogen activation
GO:0035092 sperm DNA condensation
GO:0051276 chromosome organization
GO:0071674 mononuclear cell migration
Cellular Component
GO:0000786 nucleosome
GO:0001674 female germ cell nucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0009986 cell surface

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3x1v, PDBe:3x1v, PDBj:3x1v
PDBsum3x1v
PubMed26188507
UniProtP70696|H2B1A_MOUSE Histone H2B type 1-A (Gene Name=H2bc1)

[Back to BioLiP]