Structure of PDB 3wtg Chain D

Receptor sequence
>3wtgD (length=146) Species: 8790 (Dromaius novaehollandiae) [Search protein sequence]
VQWSAEEKQLISSLWGKVNVAECGAEALARLLIVYPWTQRFFTSFGNLSS
ASAIIGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFAQLSELHCDKLHVDP
ENFRLLGDILIIVLAAHFAKEFTPECQAAWQKLVRVVAHALARKYH
3D structure
PDB3wtg Purification and preliminary structural studies of hemoglobin from high oxygen affinity species Emu (Dromaius novaehollandiae) at neutral pH
ChainD
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM D T38 F41 F42 H63 K66 S70 L88 H92 L96 N102 F103 L106 L141 T38 F41 F42 H63 K66 S70 L88 H92 L96 N102 F103 L106 L141
BS02 OXY D H63 V67 H63 V67
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
GO:0005344 oxygen carrier activity
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0031720 haptoglobin binding
GO:0043177 organic acid binding
GO:0046872 metal ion binding
Biological Process
GO:0015671 oxygen transport
GO:0042744 hydrogen peroxide catabolic process
GO:0098869 cellular oxidant detoxification
Cellular Component
GO:0005833 hemoglobin complex
GO:0031838 haptoglobin-hemoglobin complex
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wtg, PDBe:3wtg, PDBj:3wtg
PDBsum3wtg
PubMed
UniProtA0A075B5G0

[Back to BioLiP]