Structure of PDB 3wgi Chain D

Receptor sequence

>3wgiD (length=217) Species: 509192 (Thermoanaerobacter ethanolicus JW 200)

KTIVSMAVIRRLPRYHRYLEELLKNDVKRISSRELSEKMGVTASQIRQDL
NNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYT
SFEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILC
IPKDNAQYTADRLVRAGIKAIWNFLPIDLKVPDDVILENVHLSDSLFTVS
YRLNEEELFKKLKGETA

3D structure

• PDB: 3wgi Distinct structural features of Rex-family repressors to sense redox levels in anaerobes and aerobes.
• Chain: D
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	S8 R14 T45 S47 Q48 Q51 Q61 Q62	S5 R11 T42 S44 Q45 Q48 Q58 Q59
BS02	dna	D	S34 S35 R50 N54 G58 G60 Q62 G63 Y64 G65 Y66	S31 S32 R47 N51 G55 G57 Q59 G60 Y61 G62 Y63
BS03	NAJ	D	G91 G93 N94 L95 D117 I118 V135 C153 I154 P155 F177 L195 S196	G88 G90 N91 L92 D114 I115 V132 C150 I151 P152 F174 L192 S193

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0051775 response to redox state

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3wgi, PDBe:3wgi, PDBj:3wgi
• PDBsum: 3wgi
• PubMed: 25463021
• UniProt: D5KM69