Structure of PDB 3wbz Chain D

Receptor sequence
>3wbzD (length=266) Species: 237561 (Candida albicans SC5314) [Search protein sequence]
NSKYEYVKLFEKENYLLPDTYIIIRVDGKGFHKFSQFYEFEKPNDLKALQ
VMNSAAEKLMSKYSDVMLAYGDSDEYSFLLRKNCQLYERREMKLTTLFSS
LMSTYYMYFWSQYFPDKPLHIDHLPNFDARAVLYPDFKHIRNYFSWRQVD
CHINNLYNTTFWNLVLKLKMTPQQAEQRLMGTVASDKNEILFKECGVNYN
NESEMYKKGTIIVREFENYETEDEAELSKRQVQRLEKKRKKAELKIYHVD
IINDDSWWKSRPWLKD
3D structure
PDB3wbz Structural basis of reverse nucleotide polymerization
ChainD
Resolution2.392 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP D K10 R92 K95 K8 R90 K93
BS02 ATP D D29 G30 G32 F33 H34 F42 K44 D47 D76 D27 G28 G30 F31 H32 F40 K42 D45 D74
BS03 ATP D R27 R132 W148 D152 R25 R130 W146 D150
BS04 MG D D29 D76 D27 D74
BS05 MG D D29 G30 D76 D27 G28 D74
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 04:30:46 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3wbz', asym_id = 'D', title = 'Structural basis of reverse nucleotide polymerization'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3wbz', asym_id='D', title='Structural basis of reverse nucleotide polymerization')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0000287,0006400,0008193', uniprot = '', pdbid = '3wbz', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000287,0006400,0008193', uniprot='', pdbid='3wbz', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>