Structure of PDB 3v57 Chain D

Receptor sequence

>3v57D (length=177) Species: 35688 (Porphyridium purpureum) [Search protein sequence]

MLDAFSRVVVNSDAKAAYVGGSDLQALKSFIADGNKRLDAVNSIVSNASC
MVSDAVSGMICENPGLISPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DASVLEDRCLNGLKETYIALGVPTNSSIRAVSIMKAQAVAFITNTATERK
MSFAAGDCTSLASEVASYFDRVGAAIS

3D structure

PDB

3v57 pH-dependent structural conformations of B-phycoerythrin from Porphyridium cruentum

Chain

Resolution

1.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	D	M59 N72 C73 R77 R78 A81 C82 R84 D85 I88 L120 V122 P123 S126 S127	M59 N72 C73 R77 R78 A81 C82 R84 D85 I88 L120 V122 P123 S126 S127
BS02	PEB	D	N35 K36 L38 D39 I142 F153 A154 A155 G156 C158	N35 K36 L38 D39 I142 F153 A154 A155 G156 C158
BS03	PEB	D	C50 D54 S57 G58 C61 R129 A136 Q137 F141 A146 T147 E148 R149	C50 D54 S57 G58 C61 R129 A136 Q137 F141 A146 T147 E148 R149

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3v57, PDBe:3v57, PDBj:3v57
PDBsum	3v57
PubMed	22863205
UniProt	P11393\|PHEB_PORPP B-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]