Structure of PDB 3v3x Chain D |
>3v3xD (length=56) Species: 1320 (Streptococcus sp. 'group G') [Search protein sequence] |
MQYKLILCGKTLKGETTTEAVDAATAECVFKQYANDNGVDGEWTYDDATK TFTVTE |
|
PDB | 3v3x High-resolution structure of a protein spin-label in a solvent-exposed beta-sheet and comparison with DEER spectroscopy. |
Chain | D |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MTN |
D |
E27 C28 |
E27 C28 |
|
|
|
|