Structure of PDB 3sq6 Chain D

Receptor sequence

>3sq6D (length=204) Species: 9606 (Homo sapiens)

EFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDV
VFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVL
TPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSR
ELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTF
RKKG

3D structure

• PDB: 3sq6 Ligand-binding domain of an alpha 7-nicotinic receptor chimera and its complex with agonist.
• Chain: D
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EPJ	D	A105 L106 Q114	A105 L106 Q114
BS02	EPJ	D	Y91 W145 Y184 C187 Y191	Y91 W145 Y184 C187 Y191

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Mar 1 09:04:39 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3sq6', asym_id = 'D', title = 'Ligand-binding domain of an alpha 7-nicotinic receptor chimera and its complex with agonist.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3sq6', asym_id='D', title='Ligand-binding domain of an alpha 7-nicotinic receptor chimera and its complex with agonist.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004888,0005216,0005230,0006811,0016020,0022848,0034220,0045211', uniprot = '', pdbid = '3sq6', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004888,0005216,0005230,0006811,0016020,0022848,0034220,0045211', uniprot='', pdbid='3sq6', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>