Structure of PDB 3siu Chain D

Receptor sequence

>3siuD (length=125) Species: 9606 (Homo sapiens)

ADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEF
IVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACS
VTIKEGSQLKQQIQSIQQSIERLLV

3D structure

• PDB: 3siu Structural basis for the dual U4 and U4atac snRNA-binding specificity of spliceosomal protein hPrp31.
• Chain: D
• Resolution: 2.626 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	K37 G38 A39 N40 E41 K44 R48 A60 E61 I65 V95 R97 V99 I100	K34 G35 A36 N37 E38 K41 R45 A57 E58 I62 V92 R94 V96 I97	PDBbind-CN: Kd=8uM

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0030515 snoRNA binding
• GO:0030621 U4 snRNA binding
• GO:0030622 U4atac snRNA binding
• GO:0034511 U3 snoRNA binding
• GO:0034512 box C/D sno(s)RNA binding
• GO:0051117 ATPase binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0000492 box C/D snoRNP assembly
• GO:0006397 mRNA processing
• GO:0007338 single fertilization
• GO:0008380 RNA splicing
• GO:0030490 maturation of SSU-rRNA
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0001651 dense fibrillar component
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005690 U4atac snRNP
• GO:0005730 nucleolus
• GO:0031428 box C/D methylation guide snoRNP complex
• GO:0032040 small-subunit processome
• GO:0032991 protein-containing complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome
• GO:0071011 precatalytic spliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3siu, PDBe:3siu, PDBj:3siu
• PDBsum: 3siu
• PubMed: 21784869
• UniProt: P55769|NH2L1_HUMAN NHP2-like protein 1 (Gene Name=SNU13)