Structure of PDB 3rek Chain D

Receptor sequence
>3rekD (length=99) Species: 8355 (Xenopus laevis) [Search protein sequence]
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
3D structure
PDB3rek Specific DNA structural attributes modulate platinum anticancer drug site selection and cross-link generation.
ChainD
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D K24 R26 R27 T29 R30 Y39 G50 S52 S53 R83 S84 T85 K1 R3 R4 T6 R7 Y16 G27 S29 S30 R60 S61 T62
BS02 dna D R26 R30 K31 I36 Y37 R3 R7 K8 I13 Y14
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3rek, PDBe:3rek, PDBj:3rek
PDBsum3rek
PubMed21724603
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]