Structure of PDB 3qzq Chain D

Receptor sequence
>3qzqD (length=175) Species: 39054 (Enterovirus A71) [Search protein sequence]
FALSLLRRNVRQVQTDQGHFTMLGVRDRLAVLPRHSQPGKTIWIEHKLVN
VLDAVELVDEQGVNLDLTLITLDTNEKFRDITKFIPENISTASDATLVIN
TEHMPSMFVPVGDVVQYGFLNLSGKPTHRTMMYNFPTKAGQCGGVVTSVG
KIIGIHIGGNGRQGFCAGLKRSYFA
3D structure
PDB3qzq Crystal Structures of Enterovirus 71 3C Protease Complexed with Rupintrivir Reveal the Roles of Catalytically Important Residues.
ChainD
Resolution1.7001 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H40 D71 G145 C147
Catalytic site (residue number reindexed from 1) H35 D66 G140 C142
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AG7 D R39 H40 L125 N126 L127 S128 K130 T142 K143 A144 C147 H161 G163 G164 N165 F170 R34 H35 L120 N121 L122 S123 K125 T137 K138 A139 C142 H156 G158 G159 N160 F165
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0018144 RNA-protein covalent cross-linking
GO:0019062 virion attachment to host cell
GO:0046718 symbiont entry into host cell
Cellular Component
GO:0005737 cytoplasm
GO:0030430 host cell cytoplasm
GO:0039618 T=pseudo3 icosahedral viral capsid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3qzq, PDBe:3qzq, PDBj:3qzq
PDBsum3qzq
PubMed21813612
UniProtE7E815

[Back to BioLiP]