Structure of PDB 3qoq Chain D |
>3qoqD (length=48) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
ADKFVVRLPEGMREQIAEVARSHHRSMNSEIIARLEQSLLQEGALQDN |
|
PDB | 3qoq The Transcription Factor AmrZ Utilizes Multiple DNA Binding Modes to Recognize Activator and Repressor Sequences of Pseudomonas aeruginosa Virulence Genes. |
Chain | D |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
D |
V20 R22 |
V5 R7 |
|
|
|
|