Structure of PDB 3pio Chain D

Receptor sequence

>3pioD (length=177) Species: 1299 (Deinococcus radiodurans)

QLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKEDSKAIDK
AAKELALITLQKPIITKAKKSISNFKLRQGMPVGIKVTLRGERMYVFLEK
LINIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFPEITYDMVDKTRGM
DITIVTTAKTDEEARALLQSMGLPFRK

3D structure

• PDB: 3pio Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
• Chain: D
• Resolution: 3.2473 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	K33 V35 N37 K44 T68 K71 F77 L79 G86 K88 F122 R125 N127 N129 G131 I132 K133 R150 G151 M152 D153	K31 V33 N35 K42 T66 K69 F75 L77 G84 K86 F120 R123 N125 N127 G129 I130 K131 R148 G149 M150 D151
BS02	rna	D	S24 M26 A27 R30 Q63 K64 I66 K88 T90 R92	S22 M24 A25 R28 Q61 K62 I64 K86 T88 R90

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3pio, PDBe:3pio, PDBj:3pio
• PDBsum: 3pio
• PubMed: 21282615
• UniProt: Q9RXJ0|RL5_DEIRA Large ribosomal subunit protein uL5 (Gene Name=rplE)