Structure of PDB 3ojf Chain D

Receptor sequence
>3ojfD (length=256) Species: 226900 (Bacillus cereus ATCC 14579) [Search protein sequence]
ELLQGKTFVVMGVANQRSIAWGIARSLHNAGAKLIFTYAGERLERNVREL
ADTLEGQESLVLPCDVTNDEELTACFETIKQEVGTIHGVAHCIAFANRDD
LKGEFVDTSRDGFLLAQNISAFSLTAVAREAKKVMTEGGNILTLTYLGGE
RVVKNYNVMGVAKASLEASVKYLANDLGQHGIRVNAISAGPIRTLSAKGV
GDFNSILREIEERAPLRRTTTQEEVGDTAVFLFSDLARGVTGENIHVDSG
YHILGL
3D structure
PDB3ojf Dimeric and tetrameric forms of enoyl-acyl carrier protein reductase from Bacillus cereus
ChainD
Resolution2.2 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) S19 Y147 Y157 M160 K164 K199
Catalytic site (residue number reindexed from 1) S18 Y146 Y156 M159 K163 K198
Enzyme Commision number 1.3.1.9: enoyl-[acyl-carrier-protein] reductase (NADH).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 IMJ D F96 A97 Y147 N156 Y157 M160 P192 S197 V201 F95 A96 Y146 N155 Y156 M159 P191 S196 V200 MOAD: ic50=0.06uM
BS02 NDP D G13 S19 I20 A40 R43 L44 D66 V67 C93 I94 A95 L145 T146 Y147 K164 A190 P192 I193 T195 S197 G12 S18 I19 A39 R42 L43 D65 V66 C92 I93 A94 L144 T145 Y146 K163 A189 P191 I192 T194 S196
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0004318 enoyl-[acyl-carrier-protein] reductase (NADH) activity
GO:0016491 oxidoreductase activity
GO:0036094 small molecule binding
GO:0042802 identical protein binding
GO:0070401 NADP+ binding
GO:0141148 enoyl-[acyl-carrier-protein] reductase (NADPH) activity
Biological Process
GO:0006633 fatty acid biosynthetic process
GO:0030497 fatty acid elongation
Cellular Component
GO:1902494 catalytic complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ojf, PDBe:3ojf, PDBj:3ojf
PDBsum3ojf
PubMed20800575
UniProtQ81GI3|FABI_BACCR Enoyl-[acyl-carrier-protein] reductase [NADH] FabI (Gene Name=fabI)

[Back to BioLiP]