Structure of PDB 3o7l Chain D

Receptor sequence

>3o7lD (length=335) Species: 10090 (Mus musculus) [Search protein sequence]

ESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKH
KESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKD
NSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDL
IYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILS
KGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFS
SDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKPGDTSNFDDYEEEEIRVSINEKCGKEFTEF

3D structure

PDB

3o7l Dynamics connect substrate recognition to catalysis in protein kinase A.

Chain

Resolution

2.8 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	N171 D184
Catalytic site (residue number reindexed from 1)	N159 D172
Enzyme Commision number	2.7.11.11: cAMP-dependent protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	I210 I244 Y247	I198 I232 Y235

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0004672	protein kinase activity
GO:0004674	protein serine/threonine kinase activity
GO:0004679	AMP-activated protein kinase activity
GO:0004691	cAMP-dependent protein kinase activity
GO:0004712	protein serine/threonine/tyrosine kinase activity
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0019901	protein kinase binding
GO:0019904	protein domain specific binding
GO:0030145	manganese ion binding
GO:0031625	ubiquitin protein ligase binding
GO:0034237	protein kinase A regulatory subunit binding
GO:0106310	protein serine kinase activity

	Biological Process
GO:0000122	negative regulation of transcription by RNA polymerase II
GO:0001707	mesoderm formation
GO:0001843	neural tube closure
GO:0006397	mRNA processing
GO:0006468	protein phosphorylation
GO:0006611	protein export from nucleus
GO:0007189	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway
GO:0016310	phosphorylation
GO:0018105	peptidyl-serine phosphorylation
GO:0032024	positive regulation of insulin secretion
GO:0034605	cellular response to heat
GO:0045542	positive regulation of cholesterol biosynthetic process
GO:0045667	regulation of osteoblast differentiation
GO:0045722	positive regulation of gluconeogenesis
GO:0045879	negative regulation of smoothened signaling pathway
GO:0046827	positive regulation of protein export from nucleus
GO:0048240	sperm capacitation
GO:0050804	modulation of chemical synaptic transmission
GO:0051726	regulation of cell cycle
GO:0061136	regulation of proteasomal protein catabolic process
GO:0070417	cellular response to cold
GO:0070613	regulation of protein processing
GO:0071333	cellular response to glucose stimulus
GO:0071374	cellular response to parathyroid hormone stimulus
GO:0071377	cellular response to glucagon stimulus
GO:0099170	postsynaptic modulation of chemical synaptic transmission
GO:0141156	cAMP/PKA signal transduction
GO:1904262	negative regulation of TORC1 signaling
GO:1904539	negative regulation of glycolytic process through fructose-6-phosphate
GO:1990044	protein localization to lipid droplet
GO:2000810	regulation of bicellular tight junction assembly

	Cellular Component
GO:0001669	acrosomal vesicle
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005813	centrosome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005930	axoneme
GO:0005952	cAMP-dependent protein kinase complex
GO:0016607	nuclear speck
GO:0031410	cytoplasmic vesicle
GO:0031514	motile cilium
GO:0031594	neuromuscular junction
GO:0036126	sperm flagellum
GO:0044853	plasma membrane raft
GO:0048471	perinuclear region of cytoplasm
GO:0097546	ciliary base
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3o7l, PDBe:3o7l, PDBj:3o7l
PDBsum	3o7l
PubMed	20890288
UniProt	P05132\|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha (Gene Name=Prkaca)

[Back to BioLiP]