Structure of PDB 3o6t Chain D

Receptor sequence
>3o6tD (length=109) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
SATIKVTDASFATDVLSSNKPVLVDFWATWCGPSKMVAPVLEEIATERAT
DLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLR
ELSDVVPNL
3D structure
PDB3o6t Structure of Mycobacterium tuberculosis thioredoxin in complex with quinol inhibitor PMX464
ChainD
Resolution2.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C37 G38 P39 S40
Catalytic site (residue number reindexed from 1) C31 G32 P33 S34
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PX5 D W36 D66 W30 D60
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0015035 protein-disulfide reductase activity
GO:0015036 disulfide oxidoreductase activity
GO:0015038 glutathione disulfide oxidoreductase activity
GO:0016491 oxidoreductase activity
Biological Process
GO:0045454 cell redox homeostasis
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3o6t, PDBe:3o6t, PDBj:3o6t
PDBsum3o6t
PubMed20981751
UniProtP9WG67|THIO_MYCTU Thioredoxin (Gene Name=trxA)

[Back to BioLiP]