Structure of PDB 3nvi Chain D

Receptor sequence
>3nviD (length=121) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVI
IAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAII
EPGKARDLVEEIAMKVKELMK
3D structure
PDB3nvi Structural basis for substrate placement by an archaeal box C/D ribonucleoprotein particle.
ChainD
Resolution2.709 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D R34 K35 G36 T37 N38 E39 K42 R46 V58 D59 I63 K84 I93 V95 A96 A97 R31 K32 G33 T34 N35 E36 K39 R43 V55 D56 I60 K81 I90 V92 A93 A94
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3nvi, PDBe:3nvi, PDBj:3nvi
PDBsum3nvi
PubMed20864039
UniProtQ8U160|RL7A_PYRFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]