Structure of PDB 3np5 Chain D |
>3np5D (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] |
EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINISVVGPALTFRIR HNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQRE |
|
PDB | 3np5 Structure of the Mature Ectodomain of the Human Receptor-Type Protein-Tyrosine Phosphatase Ia-2 |
Chain | D |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
D |
S500 S501 G502 |
S31 S32 G33 |
|
|
|
|