Structure of PDB 3nix Chain D

Receptor sequence

>3nixD (length=403) Species: 269798 (Cytophaga hutchinsonii ATCC 33406)

KVDVLVIGAGPAGTVAASLVNKSGFKVKIVEKQKFPRFVIGESLLPRCME
HLDEAGFLDAVKAQGFQQKFGAKFVRGKEIADFNFSDQFSNGWNWTWQVP
RGNFDKTLADEAARQGVDVEYEVGVTDIKFFGTDSVTTIEDINGNKREIE
ARFIIDASGYGRVIPRMFGLDKPSGFESRRTLFTHIKDVKRPVGNRITAV
VHKPKVWIWVIPFSNGNTSVGFVGEPSYFDEYTGTPEERMRAMIANEGHI
AERFKSEEFLFEPRTIEGYAISASKLYGDGFVLTGNATEFLDPIFSSGAT
FAMESGSKGGKLAVQFLKGEEVNWEKDFVEHMMQGIDTFRSFVTGWYDGT
LHAVFFAKNPDPDHKRMICSVLAGYVWDKNNPFVKKHNTILKTLAKVIQM
GEE

3D structure

• PDB: 3nix Crystal structure of flavoprotein/dehydrogenase from Cytophaga hutchinsonii.
• Chain: D
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	D	G14 P15 A16 V34 E35 K36 Q37 R41 I44 G45 S47 R105 V129 S162 G163 Y164 V167 N295 F299 P302 S305 G307 A308 A311	G10 P11 A12 V30 E31 K32 Q33 R37 I40 G41 S43 R101 V125 S158 G159 Y160 V163 N286 F290 P293 S296 G298 A299 A302

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Feb 21 19:15:22 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3nix', asym_id = 'D', title = 'Crystal structure of flavoprotein/dehydrogenase from Cytophaga hutchinsonii.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3nix', asym_id='D', title='Crystal structure of flavoprotein/dehydrogenase from Cytophaga hutchinsonii.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0071949', uniprot = '', pdbid = '3nix', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0071949', uniprot='', pdbid='3nix', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>