Structure of PDB 3nil Chain D

Receptor sequence
>3nilD (length=81) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
GSVHKHTGRNCGRKFKIGEPLYRCHECGCDDTCVLCIHCFNPKDHVNHHV
CTDICTEFTSGICDCGDEEAWNSPLHCKAEE
3D structure
PDB3nil Structural basis for the recognition of N-end rule substrates by the UBR box of ubiquitin ligases
ChainD
Resolution1.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D R135 T144 F170 T171 S172 G173 I174 D176 A182 R23 T32 F58 T59 S60 G61 I62 D64 A70
BS02 ZN D C123 C148 C151 C175 C11 C36 C39 C63
BS03 ZN D H118 C151 C177 C189 H6 C39 C65 C77
BS04 ZN D C136 C139 H157 H160 C24 C27 H45 H48
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0071596 ubiquitin-dependent protein catabolic process via the N-end rule pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3nil, PDBe:3nil, PDBj:3nil
PDBsum3nil
PubMed20835240
UniProtP19812|UBR1_YEAST E3 ubiquitin-protein ligase UBR1 (Gene Name=UBR1)

[Back to BioLiP]