Structure of PDB 3mvd Chain D

Receptor sequence
>3mvdD (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence]
TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLA
HYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
3D structure
PDB3mvd Structure of RCC1 chromatin factor bound to the nucleosome core particle.
ChainD
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R30 K31 E32 S33 I36 Y37 R2 K3 E4 S5 I8 Y9
BS02 dna D T29 R30 Y39 G50 I51 S52 S53 R83 S84 T85 T1 R2 Y11 G22 I23 S24 S25 R55 S56 T57
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3mvd, PDBe:3mvd, PDBj:3mvd
PDBsum3mvd
PubMed20739938
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]