Structure of PDB 3mgp Chain D

Receptor sequence
>3mgpD (length=100) Species: 8355 (Xenopus laevis) [Search protein sequence]
GKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAG
EASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
3D structure
PDB3mgp Perturbations in nucleosome structure from heavy metal association.
ChainD
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R26 R27 T29 R30 S53 R83 S84 T85 R4 R5 T7 R8 S31 R61 S62 T63
BS02 dna D G23 K24 K25 R26 R27 K28 R30 K31 E32 S33 G1 K2 K3 R4 R5 K6 R8 K9 E10 S11
BS03 CO D E102 H106 E80 H84
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3mgp, PDBe:3mgp, PDBj:3mgp
PDBsum3mgp
PubMed20494975
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]