Structure of PDB 3m4b Chain D

Receptor sequence
>3m4bD (length=106) Species: 562 (Escherichia coli) [Search protein sequence]
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLED
KSPDSPEMHDFRHGFWCLIGQIHAALHLANEGKVKEAQAAAEQLKTTCNA
CHQKYR
3D structure
PDB3m4b Structural characterization of a microperoxidase inside a metal-directed protein cage.
ChainD
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN D E8 D12 E8 D12
BS02 HEM D E4 M7 N11 F61 F65 C98 C101 H102 R106 E4 M7 N11 F61 F65 C98 C101 H102 R106
BS03 ZN D D54 H59 D54 H59
BS04 ZN D A1 D39 A1 D39
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0022900 electron transport chain
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3m4b, PDBe:3m4b, PDBj:3m4b
PDBsum3m4b
PubMed20721993
UniProtP0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)

[Back to BioLiP]